![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
![]() | Species Fab 8F5 (mouse), kappa L chain [48978] (2 PDB entries) |
![]() | Domain d1a3rh2: 1a3r H:120-228 [20891] Other proteins in same PDB: d1a3rh1, d1a3rl1 |
PDB Entry: 1a3r (more details), 2.1 Å
SCOP Domain Sequences for d1a3rh2:
Sequence, based on SEQRES records: (download)
>d1a3rh2 b.1.1.2 (H:120-228) Immunoglobulin (constant domains of L and H chains) {Fab 8F5 (mouse), kappa L chain} svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss svtvtsstwpsqsitcnvahpasstkvdkkiepr
>d1a3rh2 b.1.1.2 (H:120-228) Immunoglobulin (constant domains of L and H chains) {Fab 8F5 (mouse), kappa L chain} svyplapvcssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvtvt sstwpsqsitcnvahpasstkvdkkiepr
Timeline for d1a3rh2: