| Class b: All beta proteins [48724] (180 folds) |
| Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
| Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
| Protein Adenovirus fiber protein 'knob' domain [49837] (18 species) |
| Species Human adenovirus 16 [267755] (1 PDB entry) |
| Domain d3cncc_: 3cnc C: [208908] automated match to d1h7za_ |
PDB Entry: 3cnc (more details), 2.4 Å
SCOPe Domain Sequences for d3cncc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cncc_ b.21.1.1 (C:) Adenovirus fiber protein 'knob' domain {Human adenovirus 16}
ienntlwtgakpsancvikegedspdckltlvlvkngglingyitlmgaseytntlfknn
qvtidvnlafdntgqiitylsslksnlnfkdnqnmatgtitsakgfmpsttaypfityat
etlnedyiygecyykstngtlfplkvtvtlnrrmlasgmayamnfswslnaeeapettev
tlitspfffsyiredd
Timeline for d3cncc_: