Lineage for d3cncc_ (3cnc C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2371823Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2371824Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2371825Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2371826Protein Adenovirus fiber protein "knob" domain [49837] (12 species)
  7. 2371829Species Human adenovirus 16 [267755] (1 PDB entry)
  8. 2371832Domain d3cncc_: 3cnc C: [208908]
    automated match to d1h7za_

Details for d3cncc_

PDB Entry: 3cnc (more details), 2.4 Å

PDB Description: Crystal Structure of Ad16 fiber knob
PDB Compounds: (C:) fiber protein

SCOPe Domain Sequences for d3cncc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cncc_ b.21.1.1 (C:) Adenovirus fiber protein "knob" domain {Human adenovirus 16}
ienntlwtgakpsancvikegedspdckltlvlvkngglingyitlmgaseytntlfknn
qvtidvnlafdntgqiitylsslksnlnfkdnqnmatgtitsakgfmpsttaypfityat
etlnedyiygecyykstngtlfplkvtvtlnrrmlasgmayamnfswslnaeeapettev
tlitspfffsyiredd

SCOPe Domain Coordinates for d3cncc_:

Click to download the PDB-style file with coordinates for d3cncc_.
(The format of our PDB-style files is described here.)

Timeline for d3cncc_: