SCOPe 2.06: Domain d3cncb_: 3cnc B:

Lineage for d3cncb_ (3cnc B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein Adenovirus fiber protein "knob" domain [49837] (12 species)

7. Species Human adenovirus 16 [267755] (1 PDB entry)

8. Domain d3cncb_: 3cnc B: [208907]
   automated match to d1h7za_

Details for d3cncb_

PDB Entry: 3cnc, 2.4 Å

PDB Description: Crystal Structure of Ad16 fiber knob

PDB Compounds: (B:) fiber protein

SCOPe Domain Sequences for d3cncb_:

Sequence; same for both SEQRES and ATOM records:

>d3cncb_ b.21.1.1 (B:) Adenovirus fiber protein "knob" domain {Human adenovirus 16}
ienntlwtgakpsancvikegedspdckltlvlvkngglingyitlmgaseytntlfknn
qvtidvnlafdntgqiitylsslksnlnfkdnqnmatgtitsakgfmpsttaypfityat
etlnedyiygecyykstngtlfplkvtvtlnrrmlasgmayamnfswslnaeeapettev
tlitspfffsyiredd

Timeline for d3cncb_:

• d3cncb_ first appeared in SCOPe 2.03
  
• d3cncb_ appears in SCOPe 2.05
  
• d3cncb_ appears in SCOPe 2.07
  
• d3cncb_ appears in the current release, SCOPe 2.08