Lineage for d3cncb_ (3cnc B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 1531828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 1531829Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 1531887Protein automated matches [190333] (7 species)
    not a true protein
  7. 1531931Species Human adenovirus 16 [225470] (1 PDB entry)
  8. 1531933Domain d3cncb_: 3cnc B: [208907]
    automated match to d1h7za_

Details for d3cncb_

PDB Entry: 3cnc (more details), 2.4 Å

PDB Description: Crystal Structure of Ad16 fiber knob
PDB Compounds: (B:) fiber protein

SCOPe Domain Sequences for d3cncb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cncb_ b.21.1.1 (B:) automated matches {Human adenovirus 16}
ienntlwtgakpsancvikegedspdckltlvlvkngglingyitlmgaseytntlfknn
qvtidvnlafdntgqiitylsslksnlnfkdnqnmatgtitsakgfmpsttaypfityat
etlnedyiygecyykstngtlfplkvtvtlnrrmlasgmayamnfswslnaeeapettev
tlitspfffsyiredd

SCOPe Domain Coordinates for d3cncb_:

Click to download the PDB-style file with coordinates for d3cncb_.
(The format of our PDB-style files is described here.)

Timeline for d3cncb_: