SCOPe 2.06: Domain d3cmpb_: 3cmp B:

Lineage for d3cmpb_ (3cmp B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (39 PDB entries)

8. Domain d3cmpb_: 3cmp B: [208904]
   automated match to d4iawa_
   complexed with dbh, eb4, fe, gol, na, so4; mutant

Details for d3cmpb_

PDB Entry: 3cmp, 2.8 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) k125a mutant complexed with ferric enterobactin

PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3cmpb_:

Sequence, based on SEQRES records:

>d3cmpb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
avsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

Sequence, based on observed residues (ATOM records):

>d3cmpb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailrepqkmyatiyelkedksynvt
svlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkavs
qnreyfkitlygrtkeltsenfirfskslglpenhivfpvpidqcidg

Timeline for d3cmpb_:

• d3cmpb_ first appeared in SCOPe 2.03
  
• d3cmpb_ appears in SCOPe 2.05
  
• d3cmpb_ appears in SCOPe 2.07
  
• d3cmpb_ appears in the current release, SCOPe 2.08