Lineage for d1a3rl2 (1a3r L:115-214)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 454044Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)
  8. 454083Domain d1a3rl2: 1a3r L:115-214 [20890]
    Other proteins in same PDB: d1a3rh1, d1a3rh2, d1a3rl1
    part of Fab 8F5

Details for d1a3rl2

PDB Entry: 1a3r (more details), 2.1 Å

PDB Description: fab fragment (antibody 8f5) complexed with peptide from human rhinovirus (serotype 2) viral capsid protein vp2 (residues 156-170)

SCOP Domain Sequences for d1a3rl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3rl2 b.1.1.2 (L:115-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
msstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1a3rl2:

Click to download the PDB-style file with coordinates for d1a3rl2.
(The format of our PDB-style files is described here.)

Timeline for d1a3rl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a3rl1