SCOP 1.55: Domain d1a3rl2: 1a3r L:115-214

Lineage for d1a3rl2 (1a3r L:115-214)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab 8F5 (mouse), kappa L chain [48978] (2 PDB entries)

8. Domain d1a3rl2: 1a3r L:115-214 [20890]
   Other proteins in same PDB: d1a3rh1, d1a3rl1

Details for d1a3rl2

PDB Entry: 1a3r, 2.1 Å

PDB Description: fab fragment (antibody 8f5) complexed with peptide from human rhinovirus (serotype 2) viral capsid protein vp2 (residues 156-170)

SCOP Domain Sequences for d1a3rl2:

Sequence; same for both SEQRES and ATOM records:

>d1a3rl2 b.1.1.2 (L:115-214) Immunoglobulin (constant domains of L and H chains) {Fab 8F5 (mouse), kappa L chain}
vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
msstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1a3rl2:

• d1a3rl2 appears in SCOP 1.57
  
• d1a3rl2 appears in the current release, SCOPe 2.08