SCOPe 2.07: Domain d3cmda1: 3cmd A:1-187

Lineage for d3cmda1 (3cmd A:1-187)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein automated matches [190200] (10 species)
   not a true protein

7. Species Enterococcus faecium [TaxId:1352] [226815] (1 PDB entry)

8. Domain d3cmda1: 3cmd A:1-187 [208899]
   Other proteins in same PDB: d3cmda2, d3cmdb2
   automated match to d2oklb_
   complexed with fe, mli, na

Details for d3cmda1

PDB Entry: 3cmd, 2.7 Å

PDB Description: Crystal structure of peptide deformylase from VRE-E.faecium

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d3cmda1:

Sequence, based on SEQRES records:

>d3cmda1 d.167.1.1 (A:1-187) automated matches {Enterococcus faecium [TaxId: 1352]}
mitmddiiregnptlrevakevslplseedislgkemleflknsqdpikaeelhlrggvg
laapqldiskriiavhvpspdpeadgpslstvmynpkilshsvqdaclgegegclsvdre
vpgyvvrhakitvsyydmngekhkirlknyesivvqheidhingvmfydhindqnpfalk
egvlvie

Sequence, based on observed residues (ATOM records):

>d3cmda1 d.167.1.1 (A:1-187) automated matches {Enterococcus faecium [TaxId: 1352]}
mitmddiiregnptlrevakevslplseedislgkemleflknsqdpikaeelhlrggvg
laapqldiskriiavhvpsslstvmynpkilshsvqdaclgegegclsvdrevpgyvvrh
akitvsyydmngekhkirlknyesivvqheidhingvmfydhindqnpfalkegvlvie

Timeline for d3cmda1:

• d3cmda1 first appeared in SCOPe 2.03, called d3cmda_
  
• d3cmda1 appears in SCOPe 2.06
  
• d3cmda1 appears in the current release, SCOPe 2.08