Lineage for d3ckyc2 (3cky C:167-300)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276308Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1276309Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1276508Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1276509Protein automated matches [226851] (23 species)
    not a true protein
  7. 1276530Species Eubacterium barkeri [TaxId:1528] [225506] (1 PDB entry)
  8. 1276533Domain d3ckyc2: 3cky C:167-300 [208895]
    Other proteins in same PDB: d3ckya1, d3ckyb1, d3ckyc1, d3ckyd1
    automated match to d2cvza1

Details for d3ckyc2

PDB Entry: 3cky (more details), 2.3 Å

PDB Description: Structural and Kinetic Properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation
PDB Compounds: (C:) 2-hydroxymethyl glutarate dehydrogenase

SCOPe Domain Sequences for d3ckyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ckyc2 a.100.1.0 (C:167-300) automated matches {Eubacterium barkeri [TaxId: 1528]}
tgagdavkivnnlllgcnmaslaealvlgvkcglkpetmqeiigkssgrsyameakmekf
imsgdfaggfamdlqhkdlglaleagkegnvplpmtamatqifeggramglgredmsavi
kvweqmtgvsvsgg

SCOPe Domain Coordinates for d3ckyc2:

Click to download the PDB-style file with coordinates for d3ckyc2.
(The format of our PDB-style files is described here.)

Timeline for d3ckyc2: