Lineage for d3ckyc1 (3cky C:5-166)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350474Species Eubacterium barkeri [TaxId:1528] [225505] (1 PDB entry)
  8. 1350477Domain d3ckyc1: 3cky C:5-166 [208894]
    Other proteins in same PDB: d3ckya2, d3ckyb2, d3ckyc2, d3ckyd2
    automated match to d2cvza2

Details for d3ckyc1

PDB Entry: 3cky (more details), 2.3 Å

PDB Description: Structural and Kinetic Properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation
PDB Compounds: (C:) 2-hydroxymethyl glutarate dehydrogenase

SCOPe Domain Sequences for d3ckyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ckyc1 c.2.1.0 (C:5-166) automated matches {Eubacterium barkeri [TaxId: 1528]}
ikigfiglgamgkpmainllkegvtvyafdlmeanvaavvaqgaqacennqkvaaasdii
ftslpnagivetvmngpggvlsackagtvivdmssvspsstlkmakvaaekgidyvdapv
sggtkgaeagtltimvgaseavfekiqpvlsvigkdiyhvgd

SCOPe Domain Coordinates for d3ckyc1:

Click to download the PDB-style file with coordinates for d3ckyc1.
(The format of our PDB-style files is described here.)

Timeline for d3ckyc1: