Lineage for d3cjwa1 (3cjw A:175-407)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2009679Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2009680Protein automated matches [191142] (6 species)
    not a true protein
  7. 2009693Species Human (Homo sapiens) [TaxId:9606] [189274] (53 PDB entries)
  8. 2009694Domain d3cjwa1: 3cjw A:175-407 [208885]
    Other proteins in same PDB: d3cjwa2
    automated match to d3d24a1

Details for d3cjwa1

PDB Entry: 3cjw (more details), 1.48 Å

PDB Description: Crystal structure of the human COUP-TFII ligand binding domain
PDB Compounds: (A:) COUP transcription factor 2

SCOPe Domain Sequences for d3cjwa1:

Sequence, based on SEQRES records: (download)

>d3cjwa1 a.123.1.0 (A:175-407) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsylsgyislllraepyptsrfgsqcmqpnnimgienicelaarmlfsavewarnipffp
dlqitdqvallrltwselfvlnaaqcsmplhvapllaaaglhaspmsadrvvafmdhiri
fqeqveklkalhvdsaeysclkaivlftsdacglsdvahveslqeksqcaleeyvrsqyp
nqptrfgklllrlpslrtvsssvieqlffvrlvgktpietlirdmllsgssfn

Sequence, based on observed residues (ATOM records): (download)

>d3cjwa1 a.123.1.0 (A:175-407) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsylsgyislllraepyptmgienicelaarmlfsavewarnipffpdlqitdqvallrl
twselfvlnaaqcsmplhvapvafmdhirifqeqveklkalhvdsaeysclkaivlftsd
acglsdvahveslqeksqcaleeyvrsqypnqptrfgklllrlpslrtvsssvieqlffv
rlvgktpietlirdmllsgssfn

SCOPe Domain Coordinates for d3cjwa1:

Click to download the PDB-style file with coordinates for d3cjwa1.
(The format of our PDB-style files is described here.)

Timeline for d3cjwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cjwa2