Lineage for d3cjna_ (3cjn A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (68 species)
    not a true protein
  7. 1983953Species Silicibacter pomeroyi [TaxId:246200] [225430] (2 PDB entries)
  8. 1983954Domain d3cjna_: 3cjn A: [208884]
    automated match to d2fbha1
    complexed with po4

Details for d3cjna_

PDB Entry: 3cjn (more details), 1.95 Å

PDB Description: Crystal structure of transcriptional regulator, MarR family, from Silicibacter pomeroyi
PDB Compounds: (A:) transcriptional regulator, MarR family

SCOPe Domain Sequences for d3cjna_:

Sequence, based on SEQRES records: (download)

>d3cjna_ a.4.5.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
relaeiglegyapylmnrimgrynanlrkemtalglstakmralailsakdglpigtlgi
favveqstlsraldglqadglvrrevdsddqrssrvyltpagravydrlwphmrashdrm
fqgitpqerqaflatlnkmlanirvhei

Sequence, based on observed residues (ATOM records): (download)

>d3cjna_ a.4.5.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
relaeiglegyapylmnrimgrynanlrkemtalglstakmralailsakdglpigtlgi
favveqstlsraldglqadglvrrevddqrssrvyltpagravydrlwphmrashdrmfq
gitpqerqaflatlnkmlanirvhei

SCOPe Domain Coordinates for d3cjna_:

Click to download the PDB-style file with coordinates for d3cjna_.
(The format of our PDB-style files is described here.)

Timeline for d3cjna_: