![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.56: CcmK-like [143414] (2 families) ![]() contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
![]() | Family d.58.56.1: CcmK-like [143415] (4 proteins) Pfam PF00936; BMC domain |
![]() | Protein Carboxysome shell protein CcmK2 [143420] (2 species) |
![]() | Species Synechocystis sp. [TaxId:1143] [226823] (1 PDB entry) |
![]() | Domain d3cimb1: 3cim B:4-91 [208882] Other proteins in same PDB: d3cima2, d3cimb2, d3cimc2 automated match to d3ssra_ complexed with gol, so4; mutant |
PDB Entry: 3cim (more details), 1.3 Å
SCOPe Domain Sequences for d3cimb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cimb1 d.58.56.1 (B:4-91) Carboxysome shell protein CcmK2 {Synechocystis sp. [TaxId: 1143]} avgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvsagiea anrvnggevlsthiiarphenleyvlpi
Timeline for d3cimb1:
![]() Domains from other chains: (mouse over for more information) d3cima1, d3cima2, d3cimc1, d3cimc2 |