SCOPe 2.03: Domain d3cimb_: 3cim B:

Lineage for d3cimb_ (3cim B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.56: CcmK-like [143414] (2 families)
   contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape

5. Family d.58.56.1: CcmK-like [143415] (4 proteins)
   Pfam PF00936; BMC domain

6. Protein Carboxysome shell protein CcmK2 [143420] (2 species)

7. Species Synechocystis sp. [TaxId:1143] [226823] (1 PDB entry)

8. Domain d3cimb_: 3cim B: [208882]
   automated match to d3ssra_
   complexed with gol, so4; mutant

Details for d3cimb_

PDB Entry: 3cim, 1.3 Å

PDB Description: carboxysome shell protein, ccmk2 c-terminal deletion mutant

PDB Compounds: (B:) Carbon dioxide-concentrating mechanism protein ccmK homolog 2

SCOPe Domain Sequences for d3cimb_:

Sequence; same for both SEQRES and ATOM records:

>d3cimb_ d.58.56.1 (B:) Carboxysome shell protein CcmK2 {Synechocystis sp. [TaxId: 1143]}
avgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvsagiea
anrvnggevlsthiiarphenleyvlpilehhh

Timeline for d3cimb_:

• d3cimb_ is new in SCOPe 2.03-stable
  
• d3cimb_ appears in SCOPe 2.04
  
• d3cimb_ appears in the current release, SCOPe 2.08, called d3cimb1