Lineage for d3cfwa2 (3cfw A:119-156)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2636580Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2636581Protein automated matches [226968] (4 species)
    not a true protein
  7. 2636582Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)
  8. 2636610Domain d3cfwa2: 3cfw A:119-156 [208876]
    Other proteins in same PDB: d3cfwa1
    automated match to d1g1qa2
    complexed with ca, nag

Details for d3cfwa2

PDB Entry: 3cfw (more details), 2.2 Å

PDB Description: l-selectin lectin and egf domains
PDB Compounds: (A:) L-selectin

SCOPe Domain Sequences for d3cfwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfwa2 g.3.11.0 (A:119-156) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tascqpwscsghgecveiinnytcncdvgyygpqcqfv

SCOPe Domain Coordinates for d3cfwa2:

Click to download the PDB-style file with coordinates for d3cfwa2.
(The format of our PDB-style files is described here.)

Timeline for d3cfwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cfwa1