SCOPe 2.08: Domain d3cfel1: 3cfe L:1-107

Lineage for d3cfel1 (3cfe L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3cfel1: 3cfe L:1-107 [208873]
   Other proteins in same PDB: d3cfea2, d3cfeb_, d3cfeh_, d3cfel2
   automated match to d1dqdl1
   complexed with gol, so4

Details for d3cfel1

PDB Entry: 3cfe, 2.99 Å

PDB Description: Crystal structure of purple-fluorescent antibody EP2-25C10

PDB Compounds: (L:) purple-fluorescent antibody ep2-25c10-kappa light chain

SCOPe Domain Sequences for d3cfel1:

Sequence; same for both SEQRES and ATOM records:

>d3cfel1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltisnldqddiatyfcqqgttlpptfgggtkleik

Timeline for d3cfel1:

• d3cfel1 first appeared in SCOPe 2.03
  
• d3cfel1 appears in SCOPe 2.07