Lineage for d7fabh2 (7fab H:117-217)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2022294Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 2022298Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2022317Domain d7fabh2: 7fab H:117-217 [20887]
    Other proteins in same PDB: d7fabh1, d7fabl1, d7fabl2
    part of Fab NEW

Details for d7fabh2

PDB Entry: 7fab (more details), 2 Å

PDB Description: crystal structure of human immunoglobulin fragment fab new refined at 2.0 angstroms resolution
PDB Compounds: (H:) igg1-lambda new fab (heavy chain)

SCOPe Domain Sequences for d7fabh2:

Sequence, based on SEQRES records: (download)

>d7fabh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d7fabh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
sastkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d7fabh2:

Click to download the PDB-style file with coordinates for d7fabh2.
(The format of our PDB-style files is described here.)

Timeline for d7fabh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7fabh1