SCOPe 2.05: Domain d3cfda1: 3cfd A:1-107

Lineage for d3cfda1 (3cfd A:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d3cfda1: 3cfd A:1-107 [208867]
   Other proteins in same PDB: d3cfda2, d3cfdl2
   automated match to d1dqdl1
   complexed with gol, spb

Details for d3cfda1

PDB Entry: 3cfd, 2.5 Å

PDB Description: Purple-fluorescent antibody EP2-25C10 in complex with its stilbene hapten

PDB Compounds: (A:) purple-fluorescent antibody ep2-25c10-kappa light chain

SCOPe Domain Sequences for d3cfda1:

Sequence; same for both SEQRES and ATOM records:

>d3cfda1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltisnldqddiatyfcqqgttlpptfgggtkleik

Timeline for d3cfda1:

• d3cfda1 first appeared in SCOPe 2.03
  
• d3cfda1 appears in SCOPe 2.04
  
• d3cfda1 appears in SCOPe 2.06
  
• d3cfda1 appears in the current release, SCOPe 2.08