Lineage for d3cfcl2 (3cfc L:108-214)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (522 PDB entries)
  8. 2353845Domain d3cfcl2: 3cfc L:108-214 [208866]
    Other proteins in same PDB: d3cfcl1
    automated match to d1dqdl2
    complexed with gol

Details for d3cfcl2

PDB Entry: 3cfc (more details), 1.7 Å

PDB Description: High-resolution structure of blue fluorescent antibody EP2-19G2
PDB Compounds: (L:) blue fluorescent antibody ep2-19g2-kappa light chain

SCOPe Domain Sequences for d3cfcl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfcl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d3cfcl2:

Click to download the PDB-style file with coordinates for d3cfcl2.
(The format of our PDB-style files is described here.)

Timeline for d3cfcl2: