SCOPe 2.07: Domain d3cfbl2: 3cfb L:108-213

Lineage for d3cfbl2 (3cfb L:108-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d3cfbl2: 3cfb L:108-213 [208864]
   Other proteins in same PDB: d3cfba1, d3cfbl1
   automated match to d1dqdl2
   complexed with gol, spb

Details for d3cfbl2

PDB Entry: 3cfb, 1.6 Å

PDB Description: High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene hapten at 100K

PDB Compounds: (L:) blue fluorescent antibody ep2-19g2-kappa light chain

SCOPe Domain Sequences for d3cfbl2:

Sequence; same for both SEQRES and ATOM records:

>d3cfbl2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d3cfbl2:

• d3cfbl2 first appeared in SCOPe 2.03
  
• d3cfbl2 appears in SCOPe 2.06
  
• d3cfbl2 appears in the current release, SCOPe 2.08