Lineage for d3ceib1 (3cei B:1-84)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690435Species Helicobacter pylori [TaxId:210] [225464] (1 PDB entry)
  8. 2690437Domain d3ceib1: 3cei B:1-84 [208858]
    Other proteins in same PDB: d3ceia2, d3ceib2
    automated match to d1bsma1
    complexed with fe, so4

Details for d3ceib1

PDB Entry: 3cei (more details), 2.4 Å

PDB Description: Crystal Structure of Superoxide Dismutase from Helicobacter pylori
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d3ceib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ceib1 a.2.11.0 (B:1-84) automated matches {Helicobacter pylori [TaxId: 210]}
mftlrelpfakdsmgdflspvafdfhhgkhhqtyvnnlnnlikgtdfeksslfailtkss
ggvfnnaaqiynhdfywdclspka

SCOPe Domain Coordinates for d3ceib1:

Click to download the PDB-style file with coordinates for d3ceib1.
(The format of our PDB-style files is described here.)

Timeline for d3ceib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ceib2