![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (39 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:210] [225464] (1 PDB entry) |
![]() | Domain d3ceib1: 3cei B:1-84 [208858] Other proteins in same PDB: d3ceia2, d3ceib2 automated match to d1bsma1 complexed with fe, so4 |
PDB Entry: 3cei (more details), 2.4 Å
SCOPe Domain Sequences for d3ceib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ceib1 a.2.11.0 (B:1-84) automated matches {Helicobacter pylori [TaxId: 210]} mftlrelpfakdsmgdflspvafdfhhgkhhqtyvnnlnnlikgtdfeksslfailtkss ggvfnnaaqiynhdfywdclspka
Timeline for d3ceib1: