Lineage for d8fabd2 (8fab D:122-222)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8982Species Fab HIL (human), lambda L chain [48975] (1 PDB entry)
  8. 8986Domain d8fabd2: 8fab D:122-222 [20885]
    Other proteins in same PDB: d8faba1, d8fabb1, d8fabc1, d8fabd1

Details for d8fabd2

PDB Entry: 8fab (more details), 1.8 Å

PDB Description: crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution

SCOP Domain Sequences for d8fabd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d8fabd2 b.1.1.2 (D:122-222) Immunoglobulin (constant domains of L and H chains) {Fab HIL (human), lambda L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOP Domain Coordinates for d8fabd2:

Click to download the PDB-style file with coordinates for d8fabd2.
(The format of our PDB-style files is described here.)

Timeline for d8fabd2: