Lineage for d3cbcb_ (3cbc B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2071991Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2072164Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 2072165Species Human (Homo sapiens) [TaxId:9606] [50836] (39 PDB entries)
  8. 2072180Domain d3cbcb_: 3cbc B: [208849]
    automated match to d4iawa_
    complexed with dbs, gol, na, so4

Details for d3cbcb_

PDB Entry: 3cbc (more details), 2.17 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) y106f complexed with ferric enterobactin
PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3cbcb_:

Sequence, based on SEQRES records: (download)

>d3cbcb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsflvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Sequence, based on observed residues (ATOM records): (download)

>d3cbcb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsflvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

SCOPe Domain Coordinates for d3cbcb_:

Click to download the PDB-style file with coordinates for d3cbcb_.
(The format of our PDB-style files is described here.)

Timeline for d3cbcb_: