SCOPe 2.08: Domain d3cb2b2: 3cb2 B:247-446

Lineage for d3cb2b2 (3cb2 B:247-446)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.0: automated matches [227141] (1 protein)
   not a true family

6. Protein automated matches [226843] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224983] (3 PDB entries)

8. Domain d3cb2b2: 3cb2 B:247-446 [208847]
   Other proteins in same PDB: d3cb2a1, d3cb2b1
   automated match to d1jffb2
   complexed with gdp

Details for d3cb2b2

PDB Entry: 3cb2, 2.3 Å

PDB Description: Crystal structure of human gamma-tubulin bound to GDP

PDB Compounds: (B:) Tubulin gamma-1 chain

SCOPe Domain Sequences for d3cb2b2:

Sequence, based on SEQRES records:

>d3cb2b2 d.79.2.0 (B:247-446) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gymnndligliasliptprlhflmtgytplttdqsvasvrkttvldvmrrllqpknvmvs
tgrdrqtnhcyiailniiqgevdptqvhkslqrirerklanfipwgpasiqvalsrkspy
lpsahrvsglmmanhtsisslfertcrqydklrkreafleqfrkedmfkdnfdemdtsre
ivqqlideyhaatrpdyisw

Sequence, based on observed residues (ATOM records):

>d3cb2b2 d.79.2.0 (B:247-446) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gymnndligliasliptprlhflmtgytpltkttvldvmrrllqpknvmvsttnhcyiai
lniiqgevdptqvhkslqrirerlanfipwgpasiqvalsrkspylprvsglmmanhtsi
sslfertcrqydklrkreafleqfrkedmfkdnfdemdtsreivqqlideyhaatrpdyi
sw

Timeline for d3cb2b2:

• d3cb2b2 first appeared in SCOPe 2.03
  
• d3cb2b2 appears in SCOPe 2.07