![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.0: automated matches [227136] (1 protein) not a true family |
![]() | Protein automated matches [226838] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224982] (2 PDB entries) |
![]() | Domain d3cb2a1: 3cb2 A:2-246 [208844] Other proteins in same PDB: d3cb2a2, d3cb2b2 automated match to d1tubb1 complexed with gdp |
PDB Entry: 3cb2 (more details), 2.3 Å
SCOPe Domain Sequences for d3cb2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cb2a1 c.32.1.0 (A:2-246) automated matches {Human (Homo sapiens) [TaxId: 9606]} preiitlqlgqcgnqigfefwkqlcaehgispeaiveefategtdrkdvffyqaddehyi pravlldleprvihsilnspyaklynpeniylsehgggagnnwasgfsqgekihedifdi idreadgsdslegfvlchsiaggtgsglgsyllerlndrypkklvqtysvfpnqdemsdv vvqpynslltlkrltqnadclvvldntalnriatdrlhiqnpsfsqinqlvstimsastt tlryp
Timeline for d3cb2a1: