SCOP 1.65: Domain d8fabc2: 8fab C:106-208

Lineage for d8fabc2 (8fab C:106-208)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (33 PDB entries)

8. Domain d8fabc2: 8fab C:106-208 [20884]
   Other proteins in same PDB: d8faba1, d8fabb1, d8fabb2, d8fabc1, d8fabd1, d8fabd2
   part of Fab HIL

Details for d8fabc2

PDB Entry: 8fab, 1.8 Å

PDB Description: crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution

SCOP Domain Sequences for d8fabc2:

Sequence; same for both SEQRES and ATOM records:

>d8fabc2 b.1.1.2 (C:106-208) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens)}
lgqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspikagvetttps
kqsnnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d8fabc2:

• d8fabc2 first appeared (with stable ids) in SCOP 1.55
  
• d8fabc2 appears in SCOP 1.63
  
• d8fabc2 appears in SCOP 1.67
  
• d8fabc2 appears in the current release, SCOPe 2.08