Lineage for d3cagc_ (3cag C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958075Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) (S)
    forms trimers with three closely packed beta-sheets
  5. 2958117Family d.74.2.0: automated matches [194896] (1 protein)
    not a true family
  6. 2958118Protein automated matches [194897] (4 species)
    not a true protein
  7. 2958129Species Mycobacterium tuberculosis [TaxId:83332] [194898] (3 PDB entries)
  8. 2958144Domain d3cagc_: 3cag C: [208838]
    automated match to d3buef_
    protein/DNA complex; complexed with arg

Details for d3cagc_

PDB Entry: 3cag (more details), 1.9 Å

PDB Description: crystal structure of the oligomerization domain hexamer of the arginine repressor protein from mycobacterium tuberculosis in complex with 9 arginines.
PDB Compounds: (C:) Arginine repressor

SCOPe Domain Sequences for d3cagc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cagc_ d.74.2.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ggtdrmarllgellvstddsgnlavlrtppgaahylasaidraalpqvvgtiagddtilv
varepttgaqlagmfenlr

SCOPe Domain Coordinates for d3cagc_:

Click to download the PDB-style file with coordinates for d3cagc_.
(The format of our PDB-style files is described here.)

Timeline for d3cagc_: