Lineage for d3cagb_ (3cag B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656918Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1656978Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) (S)
    forms trimers with three closely packed beta-sheets
  5. 1657020Family d.74.2.0: automated matches [194896] (1 protein)
    not a true family
  6. 1657021Protein automated matches [194897] (1 species)
    not a true protein
  7. 1657022Species Mycobacterium tuberculosis [TaxId:83332] [194898] (3 PDB entries)
  8. 1657030Domain d3cagb_: 3cag B: [208837]
    automated match to d3buef_
    protein/DNA complex; complexed with arg

Details for d3cagb_

PDB Entry: 3cag (more details), 1.9 Å

PDB Description: crystal structure of the oligomerization domain hexamer of the arginine repressor protein from mycobacterium tuberculosis in complex with 9 arginines.
PDB Compounds: (B:) Arginine repressor

SCOPe Domain Sequences for d3cagb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cagb_ d.74.2.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ggtdrmarllgellvstddsgnlavlrtppgaahylasaidraalpqvvgtiagddtilv
varepttgaqlagmfenlr

SCOPe Domain Coordinates for d3cagb_:

Click to download the PDB-style file with coordinates for d3cagb_.
(The format of our PDB-style files is described here.)

Timeline for d3cagb_: