Lineage for d3caga_ (3cag A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913462Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1913525Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) (S)
    forms trimers with three closely packed beta-sheets
  5. 1913567Family d.74.2.0: automated matches [194896] (1 protein)
    not a true family
  6. 1913568Protein automated matches [194897] (1 species)
    not a true protein
  7. 1913569Species Mycobacterium tuberculosis [TaxId:83332] [194898] (3 PDB entries)
  8. 1913576Domain d3caga_: 3cag A: [208836]
    automated match to d3buef_
    protein/DNA complex; complexed with arg

Details for d3caga_

PDB Entry: 3cag (more details), 1.9 Å

PDB Description: crystal structure of the oligomerization domain hexamer of the arginine repressor protein from mycobacterium tuberculosis in complex with 9 arginines.
PDB Compounds: (A:) Arginine repressor

SCOPe Domain Sequences for d3caga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3caga_ d.74.2.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tdrmarllgellvstddsgnlavlrtppgaahylasaidraalpqvvgtiagddtilvva
repttgaqlagmfenlr

SCOPe Domain Coordinates for d3caga_:

Click to download the PDB-style file with coordinates for d3caga_.
(The format of our PDB-style files is described here.)

Timeline for d3caga_: