![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) ![]() forms trimers with three closely packed beta-sheets |
![]() | Family d.74.2.0: automated matches [194896] (1 protein) not a true family |
![]() | Protein automated matches [194897] (4 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [194898] (3 PDB entries) |
![]() | Domain d3caga_: 3cag A: [208836] automated match to d3buef_ protein/DNA complex; complexed with arg |
PDB Entry: 3cag (more details), 1.9 Å
SCOPe Domain Sequences for d3caga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3caga_ d.74.2.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} tdrmarllgellvstddsgnlavlrtppgaahylasaidraalpqvvgtiagddtilvva repttgaqlagmfenlr
Timeline for d3caga_: