Lineage for d3cafa_ (3caf A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295367Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1295435Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 1295453Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (10 PDB entries)
  8. 1295454Domain d3cafa_: 3caf A: [208835]
    automated match to d3dara1

Details for d3cafa_

PDB Entry: 3caf (more details), 1.96 Å

PDB Description: Crystal Structure of hFGFR2 D2 Domain
PDB Compounds: (A:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d3cafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cafa_ b.1.1.4 (A:) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvv

SCOPe Domain Coordinates for d3cafa_:

Click to download the PDB-style file with coordinates for d3cafa_.
(The format of our PDB-style files is described here.)

Timeline for d3cafa_: