Lineage for d3ca6a2 (3ca6 A:129-257)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792072Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2792306Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2792307Protein automated matches [226913] (9 species)
    not a true protein
  7. 2792377Species Sambucus nigra [TaxId:4202] [225559] (8 PDB entries)
  8. 2792381Domain d3ca6a2: 3ca6 A:129-257 [208834]
    automated match to d1onkb2
    complexed with a2g, act, nag, ser, so4

Details for d3ca6a2

PDB Entry: 3ca6 (more details), 1.4 Å

PDB Description: sambucus nigra agglutinin ii (sna-ii)- tetragonal crystal form- complexed to tn antigen
PDB Compounds: (A:) Agglutinin II

SCOPe Domain Sequences for d3ca6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ca6a2 b.42.2.0 (A:129-257) automated matches {Sambucus nigra [TaxId: 4202]}
vkpivasivgykemclqsngenngvwmedceatslqqqwalygdrtirvnstrglcvttn
gynskdliiilkcqglpsqrwffnsdgaivnpksrlvmdvrasnvslreiiifpatgnpn
qqwvtqvlp

SCOPe Domain Coordinates for d3ca6a2:

Click to download the PDB-style file with coordinates for d3ca6a2.
(The format of our PDB-style files is described here.)

Timeline for d3ca6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ca6a1