Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.0: automated matches [227190] (1 protein) not a true family |
Protein automated matches [226913] (9 species) not a true protein |
Species Sambucus nigra [TaxId:4202] [225559] (8 PDB entries) |
Domain d3ca5a2: 3ca5 A:129-257 [208832] automated match to d1onkb2 complexed with act, amg, nag, so4 |
PDB Entry: 3ca5 (more details), 1.55 Å
SCOPe Domain Sequences for d3ca5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ca5a2 b.42.2.0 (A:129-257) automated matches {Sambucus nigra [TaxId: 4202]} vkpivasivgykemclqsngenngvwmedceatslqqqwalygdrtirvnstrglcvttn gynskdliiilkcqglpsqrwffnsdgaivnpksrlvmdvrasnvslreiiifpatgnpn qqwvtqvlp
Timeline for d3ca5a2: