SCOPe 2.06: Domain d3ca4a2: 3ca4 A:129-257

Lineage for d3ca4a2 (3ca4 A:129-257)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (9 species)
   not a true protein

7. Species Sambucus nigra [TaxId:4202] [225559] (8 PDB entries)

8. Domain d3ca4a2: 3ca4 A:129-257 [208830]
   automated match to d1onkb2
   complexed with act, lat, nag, so4

Details for d3ca4a2

PDB Entry: 3ca4, 1.55 Å

PDB Description: sambucus nigra agglutinin ii, tetragonal crystal form- complexed to lactose

PDB Compounds: (A:) Agglutinin II

SCOPe Domain Sequences for d3ca4a2:

Sequence; same for both SEQRES and ATOM records:

>d3ca4a2 b.42.2.0 (A:129-257) automated matches {Sambucus nigra [TaxId: 4202]}
vkpivasivgykemclqsngenngvwmedceatslqqqwalygdrtirvnstrglcvttn
gynskdliiilkcqglpsqrwffnsdgaivnpksrlvmdvrasnvslreiiifpatgnpn
qqwvtqvlp

Timeline for d3ca4a2:

• d3ca4a2 first appeared in SCOPe 2.03
  
• d3ca4a2 appears in SCOPe 2.05
  
• d3ca4a2 appears in SCOPe 2.07
  
• d3ca4a2 appears in the current release, SCOPe 2.08