Lineage for d8fabb2 (8fab B:122-223)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) 
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) 
Species Fab HIL (human), lambda L chain [48975] (1 PDB entry) 
Domain d8fabb2: 8fab B:122-223 [20883]
Other proteins in same PDB: d8faba1, d8fabb1, d8fabc1, d8fabd1
Details for d8fabb2
PDB Entry: 8fab (more details), 1.8 Å
PDB Description: crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution
SCOP Domain Sequences for d8fabb2:
Sequence, based on SEQRES records: (download)
>d8fabb2 b.1.1.2 (B:122-223) Immunoglobulin (constant domains of L and H chains) {Fab HIL (human), lambda L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
Sequence, based on observed residues (ATOM records): (download)
>d8fabb2 b.1.1.2 (B:122-223) Immunoglobulin (constant domains of L and H chains) {Fab HIL (human), lambda L chain}
astkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslgtqtyicnvnhkpsntkvdkkvepks
SCOP Domain Coordinates for d8fabb2:
Click to download the PDB-style file with coordinates for d8fabb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d8fabb2:
View in 3D
