SCOPe 2.05: Domain d3ca4a1: 3ca4 A:1-128

Lineage for d3ca4a1 (3ca4 A:1-128)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (8 species)
   not a true protein

7. Species Sambucus nigra [TaxId:4202] [225559] (8 PDB entries)

8. Domain d3ca4a1: 3ca4 A:1-128 [208829]
   automated match to d1onkb1
   complexed with act, lat, nag, so4

Details for d3ca4a1

PDB Entry: 3ca4, 1.55 Å

PDB Description: sambucus nigra agglutinin ii, tetragonal crystal form- complexed to lactose

PDB Compounds: (A:) Agglutinin II

SCOPe Domain Sequences for d3ca4a1:

Sequence; same for both SEQRES and ATOM records:

>d3ca4a1 b.42.2.0 (A:1-128) automated matches {Sambucus nigra [TaxId: 4202]}
tsftrnivgrdglcvdvrngydtdgtplqlwpcgtqrnqrwtfdsddtirsmgkcmtang
lnngsnivifncstaaenaikwevpidgsiinpssglvmtapraasrtillledniyaas
qgwtvtnn

Timeline for d3ca4a1:

• d3ca4a1 first appeared in SCOPe 2.03
  
• d3ca4a1 appears in SCOPe 2.04
  
• d3ca4a1 appears in SCOPe 2.06
  
• d3ca4a1 appears in the current release, SCOPe 2.08