SCOPe 2.03: Domain d3c9za2: 3c9z A:129-257

Lineage for d3c9za2 (3c9z A:129-257)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (4 species)
   not a true protein

7. Species Sambucus nigra [TaxId:4202] [225559] (8 PDB entries)

8. Domain d3c9za2: 3c9z A:129-257 [208822]
   automated match to d1onkb2
   complexed with act, nag, so4

Details for d3c9za2

PDB Entry: 3c9z, 1.35 Å

PDB Description: sambucus nigra agglutinin ii (sna-ii), tetragonal crystal form

PDB Compounds: (A:) Agglutinin II

SCOPe Domain Sequences for d3c9za2:

Sequence; same for both SEQRES and ATOM records:

>d3c9za2 b.42.2.0 (A:129-257) automated matches {Sambucus nigra [TaxId: 4202]}
vkpivasivgykemclqsngenngvwmedceatslqqqwalygdrtirvnstrglcvttn
gynskdliiilkcqglpsqrwffnsdgaivnpksrlvmdvrasnvslreiiifpatgnpn
qqwvtqvlp

Timeline for d3c9za2:

• d3c9za2 is new in SCOPe 2.03-stable
  
• d3c9za2 appears in SCOPe 2.04
  
• d3c9za2 appears in the current release, SCOPe 2.08