SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3c8nd_ (3c8n D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089162Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2089216Family c.1.16.0: automated matches [191510] (1 protein)
    not a true family
  6. 2089217Protein automated matches [190849] (6 species)
    not a true protein
  7. 2089234Species Mycobacterium tuberculosis [TaxId:83332] [225443] (2 PDB entries)
  8. 2089240Domain d3c8nd_: 3c8n D: [208819]
    Other proteins in same PDB: d3c8na2
    automated match to d1rhca_

Details for d3c8nd_

PDB Entry: 3c8n (more details), 1.9 Å

PDB Description: Crystal structure of apo-FGD1 from Mycobacterium tuberculosis
PDB Compounds: (D:) probable f420-dependent glucose-6-phosphate dehydrogenase fgd1

SCOPe Domain Sequences for d3c8nd_:

Sequence, based on SEQRES records: (download)

>d3c8nd_ c.1.16.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
elklgykasaeqfaprelvelavaaeahgmdsatvsdhfqpwrhqgghapfslswmtavg
ertnrlllgtsvltptfrynpaviaqafatmgclypnrvflgvgtgealneiatgyegaw
pefkerfarlresvglmrqlwsgdrvdfdgdyyrlkgasiydvpdggvpvyiaaggpava
kyagragdgfictsgkgeelyteklmpavregaaaadrsvdgidkmieikisydpdpela
mnntrfwaplsltaeqkhsiddpiemekaadalpieqiakrwivasdpdeavekvgqyvt
wglnhlvfhapghdqrrflelfqsdlaprlrr

Sequence, based on observed residues (ATOM records): (download)

>d3c8nd_ c.1.16.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
elklgykasaeqfaprelvelavaaeahgmdsatvsdhfqpwrhqgghapfslswmtavg
ertnrlllgtsvltptfrynpaviaqafatmgclypnrvflgvgtgealneiatgygawp
efkerfarlresvglmrqlwsdrvdfdgdyyrlkgasiydvpdggvpvyiaaggpavaky
agragdgfictsgkgeelyteklmpavregaaaadrsvdgidkmieikisydpdpelamn
ntrfwaplsltaeqkhsiddpiemekaadalpieqiakrwivasdpdeavekvgqyvtwg
lnhlvfhapghdqrrflelfqsdlaprlrr

SCOPe Domain Coordinates for d3c8nd_:

Click to download the PDB-style file with coordinates for d3c8nd_.
(The format of our PDB-style files is described here.)

Timeline for d3c8nd_: