Lineage for d3c8nc_ (3c8n C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1345420Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 1345474Family c.1.16.0: automated matches [191510] (1 protein)
    not a true family
  6. 1345475Protein automated matches [190849] (5 species)
    not a true protein
  7. 1345492Species Mycobacterium tuberculosis [TaxId:83332] [225443] (2 PDB entries)
  8. 1345497Domain d3c8nc_: 3c8n C: [208818]
    automated match to d1rhca_

Details for d3c8nc_

PDB Entry: 3c8n (more details), 1.9 Å

PDB Description: crystal structure of apo-fgd1 from mycobacterium tuberculosis
PDB Compounds: (C:) probable f420-dependent glucose-6-phosphate dehydrogenase fgd1

SCOPe Domain Sequences for d3c8nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c8nc_ c.1.16.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
elklgykasaeqfaprelvelavaaeahgmdsatvsdhfqpwrhqgghapfslswmtavg
ertnrlllgtsvltptfrynpaviaqafatmgclypnrvflgvgtgealneiatgyegaw
pefkerfarlresvglmrqlwsgdrvdfdgdyyrlkgasiydvpdggvpvyiaaggpava
kyagragdgfictsgkgeelyteklmpavregaaaadrsvdgidkmieikisydpdpela
mnntrfwaplsltaeqkhsiddpiemekaadalpieqiakrwivasdpdeavekvgqyvt
wglnhlvfhapghdqrrflelfqsdlaprlrr

SCOPe Domain Coordinates for d3c8nc_:

Click to download the PDB-style file with coordinates for d3c8nc_.
(The format of our PDB-style files is described here.)

Timeline for d3c8nc_: