Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) consists of clearly related families of somewhat different folds |
Family c.1.16.0: automated matches [191510] (1 protein) not a true family |
Protein automated matches [190849] (5 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [225443] (2 PDB entries) |
Domain d3c8nc_: 3c8n C: [208818] automated match to d1rhca_ |
PDB Entry: 3c8n (more details), 1.9 Å
SCOPe Domain Sequences for d3c8nc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c8nc_ c.1.16.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} elklgykasaeqfaprelvelavaaeahgmdsatvsdhfqpwrhqgghapfslswmtavg ertnrlllgtsvltptfrynpaviaqafatmgclypnrvflgvgtgealneiatgyegaw pefkerfarlresvglmrqlwsgdrvdfdgdyyrlkgasiydvpdggvpvyiaaggpava kyagragdgfictsgkgeelyteklmpavregaaaadrsvdgidkmieikisydpdpela mnntrfwaplsltaeqkhsiddpiemekaadalpieqiakrwivasdpdeavekvgqyvt wglnhlvfhapghdqrrflelfqsdlaprlrr
Timeline for d3c8nc_: