SCOPe 2.04: Domain d3c6sg2: 3c6s G:108-211

Lineage for d3c6sg2 (3c6s G:108-211)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d3c6sg2: 3c6s G:108-211 [208813]
   Other proteins in same PDB: d3c6sa1, d3c6sc1, d3c6se1, d3c6sg1
   automated match to d1dqdl2
   complexed with pd

Details for d3c6sg2

PDB Entry: 3c6s, 1.8 Å

PDB Description: crystal structure of fab f22-4 in complex with a shigella flexneri 2a o-ag pentadecasaccharide

PDB Compounds: (G:) Fab F22-4 light chain

SCOPe Domain Sequences for d3c6sg2:

Sequence; same for both SEQRES and ATOM records:

>d3c6sg2 b.1.1.2 (G:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d3c6sg2:

• d3c6sg2 first appeared in SCOPe 2.03
  
• d3c6sg2 appears in SCOPe 2.05
  
• d3c6sg2 appears in the current release, SCOPe 2.08