Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain [48974] (1 PDB entry) |
Domain d1igyd4: 1igy D:363-474 [20881] Other proteins in same PDB: d1igya1, d1igyb1, d1igyc1, d1igyd1 |
PDB Entry: 1igy (more details), 3.2 Å
SCOP Domain Sequences for d1igyd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igyd4 b.1.1.2 (D:363-474) Immunoglobulin (constant domains of L and H chains) {Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain} kprapqvytipppkeqmakdkvsltcmitdffpeditvewqsdgqapenykntqpimdtd gsyfvysklnvqksnweagntftcsvlheglhnhhtekslsh
Timeline for d1igyd4: