| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d3c6sa2: 3c6s A:108-211 [208807] Other proteins in same PDB: d3c6sa1, d3c6sb_, d3c6sc1, d3c6sd_, d3c6se1, d3c6sf_, d3c6sg1, d3c6sh_ automated match to d1dqdl2 complexed with pd |
PDB Entry: 3c6s (more details), 1.8 Å
SCOPe Domain Sequences for d3c6sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c6sa2 b.1.1.2 (A:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d3c6sa2: