SCOPe 2.08: Domain d3c5sc2: 3c5s C:108-212

Lineage for d3c5sc2 (3c5s C:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3c5sc2: 3c5s C:108-212 [208802]
   Other proteins in same PDB: d3c5sa1, d3c5sb_, d3c5sc1, d3c5sd_
   automated match to d1dqdl2

Details for d3c5sc2

PDB Entry: 3c5s, 2 Å

PDB Description: Crystal Structure of monoclonal Fab F22-4 specific for Shigella flexneri 2a O-Ag

PDB Compounds: (C:) Fab F22-4 light chain

SCOPe Domain Sequences for d3c5sc2:

Sequence; same for both SEQRES and ATOM records:

>d3c5sc2 b.1.1.2 (C:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d3c5sc2:

• d3c5sc2 first appeared in SCOPe 2.03
  
• d3c5sc2 appears in SCOPe 2.07