Lineage for d3c5la1 (3c5l A:373-494)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2239931Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 2239932Superfamily d.223.1: Polo-box domain [82615] (3 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 2239944Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
    duplication: consists of two polo-box domains; binds phosphothreonine peptide
  6. 2239945Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)
  7. 2239946Species Human (Homo sapiens) [TaxId:9606] [102858] (23 PDB entries)
  8. 2240001Domain d3c5la1: 3c5l A:373-494 [208797]
    automated match to d1q4kc1

Details for d3c5la1

PDB Entry: 3c5l (more details), 2.33 Å

PDB Description: Polo-like kinase 1 Polo box domain in complex with PPHSpT peptide
PDB Compounds: (A:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d3c5la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c5la1 d.223.1.2 (A:373-494) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdnsv
gvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehllk
ag

SCOPe Domain Coordinates for d3c5la1:

Click to download the PDB-style file with coordinates for d3c5la1.
(The format of our PDB-style files is described here.)

Timeline for d3c5la1: