SCOPe 2.08: Domain d3c5jb2: 3c5j B:93-190

Lineage for d3c5jb2 (3c5j B:93-190)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3c5jb2: 3c5j B:93-190 [208796]
   Other proteins in same PDB: d3c5ja1, d3c5ja2, d3c5jb1
   automated match to d1fv1b1
   complexed with nag, so4

Details for d3c5jb2

PDB Entry: 3c5j, 1.8 Å

PDB Description: crystal structure of hla dr52c

PDB Compounds: (B:) MHC class II antigen

SCOPe Domain Sequences for d3c5jb2:

Sequence, based on SEQRES records:

>d3c5jb2 b.1.1.2 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrvhpqvtvypaktqplqhhnllvcsvsgfypgsievrwfrngqeektgvvstglihngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records):

>d3c5jb2 b.1.1.2 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrvhpqvtvypakhhnllvcsvsgfypgsievrwfrngqeektgvvstglihngdwtfqt
lvmletvprsgevytcqvehpsvtspltvewra

Timeline for d3c5jb2:

• d3c5jb2 first appeared in SCOPe 2.03
  
• d3c5jb2 appears in SCOPe 2.07