| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d3c5jb2: 3c5j B:93-190 [208796] Other proteins in same PDB: d3c5ja1, d3c5ja2, d3c5jb1 automated match to d1fv1b1 complexed with nag, so4 |
PDB Entry: 3c5j (more details), 1.8 Å
SCOPe Domain Sequences for d3c5jb2:
Sequence, based on SEQRES records: (download)
>d3c5jb2 b.1.1.2 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrvhpqvtvypaktqplqhhnllvcsvsgfypgsievrwfrngqeektgvvstglihngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra
>d3c5jb2 b.1.1.2 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrvhpqvtvypakhhnllvcsvsgfypgsievrwfrngqeektgvvstglihngdwtfqt
lvmletvprsgevytcqvehpsvtspltvewra
Timeline for d3c5jb2: