Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries) |
Domain d3c5jb1: 3c5j B:4-92 [208795] Other proteins in same PDB: d3c5ja1, d3c5ja2, d3c5jb2 automated match to d1fv1b2 complexed with nag, so4 |
PDB Entry: 3c5j (more details), 1.8 Å
SCOPe Domain Sequences for d3c5jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c5jb1 d.19.1.0 (B:4-92) automated matches {Human (Homo sapiens) [TaxId: 9606]} rprflellksechffngtervrfleryfhnqeefvrfdsdvgeyravtelgrpvaeswns qkdlleqkrgqvdnycrhnygvvesftvq
Timeline for d3c5jb1: