Lineage for d3c5jb1 (3c5j B:4-92)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1898167Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 1898168Protein automated matches [226842] (4 species)
    not a true protein
  7. 1898181Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries)
  8. 1898182Domain d3c5jb1: 3c5j B:4-92 [208795]
    Other proteins in same PDB: d3c5ja1, d3c5ja2, d3c5jb2
    automated match to d1fv1b2
    complexed with nag, so4

Details for d3c5jb1

PDB Entry: 3c5j (more details), 1.8 Å

PDB Description: crystal structure of hla dr52c
PDB Compounds: (B:) MHC class II antigen

SCOPe Domain Sequences for d3c5jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c5jb1 d.19.1.0 (B:4-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rprflellksechffngtervrfleryfhnqeefvrfdsdvgeyravtelgrpvaeswns
qkdlleqkrgqvdnycrhnygvvesftvq

SCOPe Domain Coordinates for d3c5jb1:

Click to download the PDB-style file with coordinates for d3c5jb1.
(The format of our PDB-style files is described here.)

Timeline for d3c5jb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c5jb2