SCOPe 2.04: Domain d3c5ja2: 3c5j A:82-180

Lineage for d3c5ja2 (3c5j A:82-180)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
   Uniprot P01903 28-207
   probably orthologous to the mouse I-E group

8. Domain d3c5ja2: 3c5j A:82-180 [208794]
   Other proteins in same PDB: d3c5ja1, d3c5jb1, d3c5jb2
   automated match to d1fv1a1
   complexed with nag, so4

Details for d3c5ja2

PDB Entry: 3c5j, 1.8 Å

PDB Description: crystal structure of hla dr52c

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d3c5ja2:

Sequence; same for both SEQRES and ATOM records:

>d3c5ja2 b.1.1.2 (A:82-180) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

Timeline for d3c5ja2:

• d3c5ja2 first appeared in SCOPe 2.03
  
• d3c5ja2 appears in SCOPe 2.05
  
• d3c5ja2 appears in the current release, SCOPe 2.08