Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries) |
Domain d3c5cb_: 3c5c B: [208790] Other proteins in same PDB: d3c5cc2 automated match to d3gftc_ complexed with gdp, mg, unx |
PDB Entry: 3c5c (more details), 1.85 Å
SCOPe Domain Sequences for d3c5cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c5cb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} levnlailgrrgagksaltvkfltkrfiseydpnledtysseetvdhqpvhlrvmdtadl dtprncerylnwahaflvvysvdsrqsfdssssylellalhaketqrsipalllgnkldm aqyrqvtkaegvalagrfgclffevsacldfehvqhvfheavrearr
Timeline for d3c5cb_:
View in 3D Domains from other chains: (mouse over for more information) d3c5ca_, d3c5cc1, d3c5cc2, d3c5cd_ |