Lineage for d3c5ca_ (3c5c A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366245Species Human (Homo sapiens) [TaxId:9606] [186862] (75 PDB entries)
  8. 1366264Domain d3c5ca_: 3c5c A: [208789]
    automated match to d3gftc_
    complexed with gdp, mg, unx

Details for d3c5ca_

PDB Entry: 3c5c (more details), 1.85 Å

PDB Description: crystal structure of human ras-like, family 12 protein in complex with gdp
PDB Compounds: (A:) RAS-like protein 12

SCOPe Domain Sequences for d3c5ca_:

Sequence, based on SEQRES records: (download)

>d3c5ca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
levnlailgrrgagksaltvkfltkrfiseydpnledtysseetvdhqpvhlrvmdtadl
dtprncerylnwahaflvvysvdsrqsfdssssylellalhaketqrsipalllgnkldm
aqyrqvtkaegvalagrfgclffevsacldfehvqhvfheavrearr

Sequence, based on observed residues (ATOM records): (download)

>d3c5ca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
levnlailgrrgagksaltvkfltkrfiseydpnledtysseetvdhqpvhlrvmdtadp
rncerylnwahaflvvysvdsrqsfdssssylellalhaketqrsipalllgnkldmaqy
rqvtkaegvalagrfgclffevsacldfehvqhvfheavrearr

SCOPe Domain Coordinates for d3c5ca_:

Click to download the PDB-style file with coordinates for d3c5ca_.
(The format of our PDB-style files is described here.)

Timeline for d3c5ca_: